Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins) |
Protein Alpha-amino acid ester hydrolase [89247] (2 species) |
Species Acetobacter pasteurianus [TaxId:438] [101591] (4 PDB entries) |
Domain d1nx9a1: 1nx9 A:435-666 [92285] Other proteins in same PDB: d1nx9a2, d1nx9b2, d1nx9c2, d1nx9d2 complexed with aic, gol; mutant |
PDB Entry: 1nx9 (more details), 2.2 Å
SCOPe Domain Sequences for d1nx9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nx9a1 b.18.1.13 (A:435-666) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} psvcesnctggltplyladghglsfthpaadgadsyvsdpahpvpfisrpfafaqssrwk pwlvqdqreaesrpdvvtyetevldepvrvsgvpvadlfaatsgtdsdwvvklidvqpam tpddpkmggyelpvsmdifrgryrkdfakpealqpdatlhyhftlpavnhvfakghrimv qiqsswfplydrnpqkfvpnifdakpadytvatqsihhggkeatsillpvvk
Timeline for d1nx9a1: