Lineage for d1nw3a_ (1nw3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893876Family c.66.1.31: Catalytic, N-terminal domain of histone methyltransferase Dot1l [89746] (2 proteins)
  6. 2893877Protein Catalytic, N-terminal domain of histone methyltransferase Dot1l [89747] (2 species)
    a non-SET domain nucleosomal histone methyltransferase
  7. 2893882Species Human (Homo sapiens) [TaxId:9606] [89748] (1 PDB entry)
  8. 2893883Domain d1nw3a_: 1nw3 A: [86288]
    complexed with act, sam, so4

Details for d1nw3a_

PDB Entry: 1nw3 (more details), 2.5 Å

PDB Description: Structure of the Catalytic domain of human DOT1L, a non-SET domain nucleosomal histone methyltransferase
PDB Compounds: (A:) histone methyltransferase DOT1L

SCOPe Domain Sequences for d1nw3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]}
lelrlkspvgaepavypwplpvydkhhdaaheiietirwvceeipdlklamenyvlidyd
tksfesmqrlcdkynraidsihqlwkgttqpmklntrpstgllrhilqqvynhsvtdpek
lnnyepfspevygetsfdlvaqmideikmtdddlfvdlgsgvgqvvlqvaaatnckhhyg
vekadipakyaetmdrefrkwmkwygkkhaeytlergdflseewreriantsvifvnnfa
fgpevdhqlkerfanmkeggrivsskpfaplnfrinsrnlsdigtimrvvelsplkgsvs
wtgkpvsyylhtidrtilenyfsslknp

SCOPe Domain Coordinates for d1nw3a_:

Click to download the PDB-style file with coordinates for d1nw3a_.
(The format of our PDB-style files is described here.)

Timeline for d1nw3a_: