| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein cH-p21 Ras protein [52593] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52594] (160 PDB entries) Uniprot Q6P716 |
| Domain d1nvvq_: 1nvv Q: [86277] Other proteins in same PDB: d1nvvs_ complexed with gnp, mg, po4 |
PDB Entry: 1nvv (more details), 2.18 Å
SCOPe Domain Sequences for d1nvvq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nvvq_ c.37.1.8 (Q:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeasamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
Timeline for d1nvvq_: