Lineage for d1nuka_ (1nuk A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304969Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1304970Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1305041Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
    automatically mapped to Pfam PF01404
  6. 1305046Protein Ligand-binding domain of the ephb2 receptor tyrosine kinase [49801] (1 species)
  7. 1305047Species Mouse (Mus musculus) [TaxId:10090] [49802] (4 PDB entries)
    Uniprot P54763 27-207
  8. 1305054Domain d1nuka_: 1nuk A: [23721]

Details for d1nuka_

PDB Entry: 1nuk (more details), 2.9 Å

PDB Description: crystal structure of the ligand-binding domain of the ephb2 receptor tyrosine kinase
PDB Compounds: (A:) protein (tyrosine-protein kinase receptor eph)

SCOPe Domain Sequences for d1nuka_:

Sequence, based on SEQRES records: (download)

>d1nuka_ b.18.1.4 (A:) Ligand-binding domain of the ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
eetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfir
rrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkvd
tiaadesfsqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyr

Sequence, based on observed residues (ATOM records): (download)

>d1nuka_ b.18.1.4 (A:) Ligand-binding domain of the ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
eetlmdsttataelgwmvhppsgweevsgydntirtyqvcnvfessqnnwlrtkfirrrg
ahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkvdtia
adesfsqvdvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyr

SCOPe Domain Coordinates for d1nuka_:

Click to download the PDB-style file with coordinates for d1nuka_.
(The format of our PDB-style files is described here.)

Timeline for d1nuka_: