Lineage for d1nuea_ (1nue A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557935Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2557936Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2557937Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2557992Species Human (Homo sapiens) [TaxId:9606] [54922] (5 PDB entries)
  8. 2558011Domain d1nuea_: 1nue A: [39076]
    complexed with gdp, mg

Details for d1nuea_

PDB Entry: 1nue (more details), 2 Å

PDB Description: x-ray structure of nm23 human nucleoside diphosphate kinase b complexed with gdp at 2 angstroms resolution
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1nuea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nuea_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]}
anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svksaekeislwfkpeelvdykscahdwvye

SCOPe Domain Coordinates for d1nuea_:

Click to download the PDB-style file with coordinates for d1nuea_.
(The format of our PDB-style files is described here.)

Timeline for d1nuea_: