Lineage for d1nu6a2 (1nu6 A:509-766)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508876Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. 2508883Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 2508884Species Human (Homo sapiens) [TaxId:9606] [82499] (58 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 2508929Domain d1nu6a2: 1nu6 A:509-766 [92186]
    Other proteins in same PDB: d1nu6a1, d1nu6b1
    complexed with hg, nag, ndg

Details for d1nu6a2

PDB Entry: 1nu6 (more details), 2.1 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv (dpp-iv)
PDB Compounds: (A:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d1nu6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nu6a2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d1nu6a2:

Click to download the PDB-style file with coordinates for d1nu6a2.
(The format of our PDB-style files is described here.)

Timeline for d1nu6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nu6a1