Lineage for d1nu3b_ (1nu3 B:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.17: Cystatin-like [54402] (7 superfamilies)
Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheetSuperfamily d.17.4: NTF2-like [54427] (31 families) 
has a beta-alpha(2)-beta insertion after the main helix
Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (3 proteins)
automatically mapped to Pfam PF07858Protein Limonene-1,2-epoxide hydrolase [89855] (1 species) Species Rhodococcus erythropolis [TaxId:1833] [89856] (14 PDB entries) 
Domain d1nu3b_: 1nu3 B: [86171]
complexed with mes, vpr
Details for d1nu3b_
PDB Entry: 1nu3 (more details), 1.75 Å
PDB Description: limonene-1,2-epoxide hydrolase in complex with valpromide
PDB Compounds: (B:) limonene-1,2-epoxide hydrolaseSCOPe Domain Sequences for d1nu3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nu3b_ d.17.4.8 (B:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]}
skieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyqnmplppay
grdaveqtlaglftvmsidavetfhigssnglvytervdvlralptgksynlsilgvfql
tegkitgwrdyfdlrefeeavdlplrg
SCOPe Domain Coordinates for d1nu3b_:
Click to download the PDB-style file with coordinates for d1nu3b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nu3b_:
- d1nu3b_ first appeared in SCOP 1.65
- d1nu3b_ appears in SCOPe 2.05
- d1nu3b_ appears in SCOPe 2.07
- d1nu3b_ appears in the current release, SCOPe 2.08
View in 3D
