Lineage for d1ntya1 (1nty A:1231-1414)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
multihelical; core: 5-helical bundleSuperfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) 
automatically mapped to Pfam PF00621Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
Pfam PF00621Protein Triple functional domain protein TRIO [109935] (1 species) Species Human (Homo sapiens) [TaxId:9606] [109936] (3 PDB entries)
Uniprot O75962 1231-1535
Domain d1ntya1: 1nty A:1231-1414 [103873]
Other proteins in same PDB: d1ntya2
Details for d1ntya1
PDB Entry: 1nty (more details), 1.7 Å
PDB Description: crystal structure of the first dh/ph domain of trio to 1.7 a
PDB Compounds: (A:) triple functional domain proteinSCOPe Domain Sequences for d1ntya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntya1 a.87.1.1 (A:1231-1414) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]}
arrkefimaeliqtekayvrdlrecmdtylwemtsgveeippgivnkeliifgnmqeiye
fhnniflkelekyeqlpedvghcfvtwadkfqmyvtycknkpdstqlilehagsyfdeiq
qrhglansissylikpvqritkyqlllkelltcceegkgeikdglevmlsvpkrandamh
lsml
SCOPe Domain Coordinates for d1ntya1:
Click to download the PDB-style file with coordinates for d1ntya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ntya1:
- d1ntya1 first appeared in SCOP 1.69
- d1ntya1 appears in SCOPe 2.06
- d1ntya1 appears in the current release, SCOPe 2.08
View in 3D
