Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins) |
Protein Cytochrome bc1 domain [46677] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [46678] (18 PDB entries) Uniprot P00125 |
Domain d1ntmd1: 1ntm D:1-195 [92127] Other proteins in same PDB: d1ntma1, d1ntma2, d1ntmb1, d1ntmb2, d1ntmc1, d1ntmc2, d1ntmd2, d1ntme1, d1ntme2, d1ntmf_, d1ntmg_, d1ntmh_, d1ntmi_, d1ntmj_, d1ntmk_ complexed with fes, hem |
PDB Entry: 1ntm (more details), 2.4 Å
SCOPe Domain Sequences for d1ntmd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntmd1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]} sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms qvakdvctflrwaae
Timeline for d1ntmd1: