SCOPe 2.06: Domain d1ntmd1: 1ntm D:1-195

Lineage for d1ntmd1 (1ntm D:1-195)

Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds)
Fold a.3: Cytochrome c [46625] (1 superfamily)
core: 3 helices; folded leaf, opened
Superfamily a.3.1: Cytochrome c [46626] (9 families)
covalently-bound heme completes the core
Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
Protein Cytochrome bc1 domain [46677] (3 species)
Species Cow (Bos taurus) [TaxId:9913] [46678] (18 PDB entries)
Uniprot P00125

Domain d1ntmd1: 1ntm D:1-195 [92127]
Other proteins in same PDB: d1ntma1, d1ntma2, d1ntmb1, d1ntmb2, d1ntmc1, d1ntmc2, d1ntmd2, d1ntme1, d1ntme2, d1ntmf_, d1ntmg_, d1ntmh_, d1ntmi_, d1ntmj_, d1ntmk_
complexed with fes, hem

Details for d1ntmd1

PDB Entry: 1ntm (more details), 2.4 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex at 2.4 Angstrom

PDB Compounds: (D:) cytochrome c1

SCOPe Domain Sequences for d1ntmd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntmd1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

SCOPe Domain Coordinates for d1ntmd1:

Click to download the PDB-style file with coordinates for d1ntmd1.
(The format of our PDB-style files is described here.)

Timeline for d1ntmd1: