SCOPe 2.08: Domain d1ntmb2: 1ntm B:236-439

Lineage for d1ntmb2 (1ntm B:236-439)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

Family d.185.1.1: MPP-like [63412] (7 proteins)
Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

Protein Cytochrome bc1 core subunit 2 [63409] (4 species)
Species Cow (Bos taurus) [TaxId:9913] [56000] (19 PDB entries)
Uniprot P23004

Domain d1ntmb2: 1ntm B:236-439 [92124]
Other proteins in same PDB: d1ntma1, d1ntma2, d1ntmc1, d1ntmc2, d1ntmd1, d1ntmd2, d1ntme1, d1ntme2, d1ntmf_, d1ntmg_, d1ntmh_, d1ntmi_, d1ntmj_, d1ntmk_
complexed with fes, hem

Details for d1ntmb2

PDB Entry: 1ntm (more details), 2.4 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex at 2.4 Angstrom

PDB Compounds: (B:) Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial

SCOPe Domain Sequences for d1ntmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntmb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

SCOPe Domain Coordinates for d1ntmb2:

Click to download the PDB-style file with coordinates for d1ntmb2.
(The format of our PDB-style files is described here.)

Timeline for d1ntmb2: