Lineage for d1ntfa_ (1ntf A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224399Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2224400Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2224474Family d.151.1.2: Inositol polyphosphate 5-phosphatase (IPP5) [64422] (3 proteins)
  6. 2224475Protein Salivary nitrophorin [103310] (1 species)
    heme-binding homologue of IPP5
  7. 2224476Species Bedbug (Cimex lectularius) [TaxId:79782] [103311] (3 PDB entries)
  8. 2224479Domain d1ntfa_: 1ntf A: [92104]
    complexed with hem

Details for d1ntfa_

PDB Entry: 1ntf (more details), 1.8 Å

PDB Description: Crystal Structure of Cimex Nitrophorin
PDB Compounds: (A:) Salivary nitrophorin

SCOPe Domain Sequences for d1ntfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntfa_ d.151.1.2 (A:) Salivary nitrophorin {Bedbug (Cimex lectularius) [TaxId: 79782]}
ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
nfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl

SCOPe Domain Coordinates for d1ntfa_:

Click to download the PDB-style file with coordinates for d1ntfa_.
(The format of our PDB-style files is described here.)

Timeline for d1ntfa_: