Lineage for d1nsqa_ (1nsq A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2194362Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2194363Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2194364Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2194391Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [54926] (2 PDB entries)
  8. 2194392Domain d1nsqa_: 1nsq A: [39135]

Details for d1nsqa_

PDB Entry: 1nsq (more details), 2.18 Å

PDB Description: mechanism of phosphate transfer by nucleoside diphosphate kinase: x-ray structures of a phospho-histidine intermediate of the enzymes from drosophila and dictyostelium
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1nsqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aankertfimvkpdgvqrglvgkiierfeqkgfklvalkftwaskellekhyadlsarpf
fpglvnymnsgpvvpmvweglnvvktgrqmlgatnpadslpgtirgdfciqvgrniihgs
davesaekeialwfnekelvtwtpaakdwiye

SCOPe Domain Coordinates for d1nsqa_:

Click to download the PDB-style file with coordinates for d1nsqa_.
(The format of our PDB-style files is described here.)

Timeline for d1nsqa_: