Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) |
Protein N-(5'phosphoribosyl)antranilate isomerase, PRAI [51382] (3 species) |
Species Thermotoga maritima [TaxId:2336] [51384] (3 PDB entries) |
Domain d1nsja_: 1nsj A: [28560] complexed with po4 |
PDB Entry: 1nsj (more details), 2 Å
SCOPe Domain Sequences for d1nsja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nsja_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]} mvrvkicgitnledalfsvesgadavgfvfypkskryispedarrisvelppfvfrvgvf vneepekildvasyvqlnavqlhgeepielcrkiaerilvikavgvsnerdmeralnyre fpilldtktpeyggsgktfdwslilpyrdrfrylvlsgglnpenvrsaidvvrpfavdvs sgveafpgkkdhdsikmfiknakgl
Timeline for d1nsja_: