Lineage for d1nsha_ (1nsh A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, openedSuperfamily a.39.1: EF-hand [47473] (12 families) 
Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
Family a.39.1.2: S100 proteins [47478] (2 proteins)
dimer: subunits are made of two EF-handsProtein Calcyclin (S100) [47479] (17 species) 
Species Rabbit (Oryctolagus cuniculus), calgizzarin s100a11 [TaxId:9986] [89047] (1 PDB entry) 
Domain d1nsha_: 1nsh A: [86135]
Details for d1nsha_
PDB Entry: 1nsh (more details)
PDB Description: solution structure of rabbit apo-s100a11 (19 models)
PDB Compounds: (A:) CalgizzarinSCOPe Domain Sequences for d1nsha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nsha_ a.39.1.2 (A:) Calcyclin (S100) {Rabbit (Oryctolagus cuniculus), calgizzarin s100a11 [TaxId: 9986]}
srpteterciesliavfqkyagkdghsvtlskteflsfmntelaaftknqkdpgvldrmm
kkldlnsdgqldfqeflnligglavachesfvkaappqkrf
SCOPe Domain Coordinates for d1nsha_:
Click to download the PDB-style file with coordinates for d1nsha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nsha_:
- d1nsha_ first appeared in SCOP 1.65
- d1nsha_ appears in SCOPe 2.07
View in 3D
