Lineage for d1nrga_ (1nrg A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403705Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2403706Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2403707Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 2403792Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species)
    elaborated with additional secondary structures; active as dimer
  7. 2403805Species Human (Homo sapiens) [TaxId:9606] [82120] (1 PDB entry)
  8. 2403806Domain d1nrga_: 1nrg A: [80694]
    complexed with bme, fmn, plp, po4

Details for d1nrga_

PDB Entry: 1nrg (more details), 1.95 Å

PDB Description: structure and properties of recombinant human pyridoxine-5'-phosphate oxidase
PDB Compounds: (A:) pyridoxine 5'-phosphate oxidase

SCOPe Domain Sequences for d1nrga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nrga_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Human (Homo sapiens) [TaxId: 9606]}
eethltsldpvkqfaawfeeavqcpdigeanamclatctrdgkpsarmlllkgfgkdgfr
fftnfesrkgkeldsnpfaslvfyweplnrqvrvegpvkklpeeeaecyfhsrpkssqig
avvshqssvipdreylrkkneeleqlyqdqevpkpkswggyvlypqvmefwqgqtnrlhd
rivfrrglptgdsplgpmthrgeedwlyerlap

SCOPe Domain Coordinates for d1nrga_:

Click to download the PDB-style file with coordinates for d1nrga_.
(The format of our PDB-style files is described here.)

Timeline for d1nrga_: