![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
![]() | Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species) elaborated with additional secondary structures; active as dimer |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82120] (1 PDB entry) |
![]() | Domain d1nrga_: 1nrg A: [80694] complexed with bme, fmn, plp, po4 |
PDB Entry: 1nrg (more details), 1.95 Å
SCOPe Domain Sequences for d1nrga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nrga_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Human (Homo sapiens) [TaxId: 9606]} eethltsldpvkqfaawfeeavqcpdigeanamclatctrdgkpsarmlllkgfgkdgfr fftnfesrkgkeldsnpfaslvfyweplnrqvrvegpvkklpeeeaecyfhsrpkssqig avvshqssvipdreylrkkneeleqlyqdqevpkpkswggyvlypqvmefwqgqtnrlhd rivfrrglptgdsplgpmthrgeedwlyerlap
Timeline for d1nrga_: