![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein Penicillin receptor BlaR, C-terminal domain [103375] (1 species) closely related to class D beta-lactamase |
![]() | Species Bacillus licheniformis [TaxId:1402] [103376] (1 PDB entry) |
![]() | Domain d1nrfa_: 1nrf A: [92086] |
PDB Entry: 1nrf (more details), 2.5 Å
SCOPe Domain Sequences for d1nrfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nrfa_ e.3.1.1 (A:) Penicillin receptor BlaR, C-terminal domain {Bacillus licheniformis [TaxId: 1402]} flpgtnveyedystffdkfsasggfvlfnsnrkkytiynrkestsrfapastykvfsall alesgiitkndshmtwdgtqypykewnqdqdlfsamsssttwyfqkldrqigedhlrhyl ksihygnedfsvpadywldgslqispleqvnilkkfydnefdfkqsnietvkdsirlees ngrvlsgktgtsvingelhagwfigyvetadntfffavhiqgekraagssaaeialsild kkgiyp
Timeline for d1nrfa_: