Lineage for d1npua_ (1npu A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757735Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)
  7. 1757739Species Mouse (Mus musculus) [TaxId:10090] [101511] (5 PDB entries)
  8. 1757742Domain d1npua_: 1npu A: [92038]

Details for d1npua_

PDB Entry: 1npu (more details), 2 Å

PDB Description: crystal structure of the extracellular domain of murine pd-1
PDB Compounds: (A:) Programmed cell death protein 1

SCOPe Domain Sequences for d1npua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1npua_ b.1.1.1 (A:) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]}
sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda
rfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpkakieespgaelvvteril

SCOPe Domain Coordinates for d1npua_:

Click to download the PDB-style file with coordinates for d1npua_.
(The format of our PDB-style files is described here.)

Timeline for d1npua_: