![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.78: beta-Prism II [51109] (1 superfamily) consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis duplication: consists of two domains of this fold |
![]() | Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) ![]() |
![]() | Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (4 proteins) |
![]() | Protein Lectin (agglutinin) [51112] (4 species) |
![]() | Species Daffodil (Narcissus pseudonarcissus) [TaxId:39639] [51115] (2 PDB entries) |
![]() | Domain d1npla_: 1npl A: [27997] complexed with po4 |
PDB Entry: 1npl (more details), 2 Å
SCOPe Domain Sequences for d1npla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1npla_ b.78.1.1 (A:) Lectin (agglutinin) {Daffodil (Narcissus pseudonarcissus) [TaxId: 39639]} dnilysgetlspgeflnngryvfimqedcnlvlydvdkpiwatntggldrrchlsmqsdg nlvvysprnnpiwasntggengnyvcvlqkdrnvviygtarwatgtnih
Timeline for d1npla_: