Lineage for d1npha1 (1nph A:414-532)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576227Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2576228Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2576229Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2576230Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 2576247Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries)
    Uniprot P20065 55-179
  8. 2576319Domain d1npha1: 1nph A:414-532 [85956]
    domains 4, 5 and 6 in active, actin free conformation
    complexed with ca

Details for d1npha1

PDB Entry: 1nph (more details), 3 Å

PDB Description: Gelsolin Domains 4-6 in Active, Actin Free Conformation Identifies Sites of Regulatory Calcium Ions
PDB Compounds: (A:) gelsolin

SCOPe Domain Sequences for d1npha1:

Sequence, based on SEQRES records: (download)

>d1npha1 d.109.1.1 (A:414-532) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
ddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqstq
devaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsrdggqta

Sequence, based on observed residues (ATOM records): (download)

>d1npha1 d.109.1.1 (A:414-532) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
ddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynygqiiynwqgaqstqdevaas
ailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsrdggqta

SCOPe Domain Coordinates for d1npha1:

Click to download the PDB-style file with coordinates for d1npha1.
(The format of our PDB-style files is described here.)

Timeline for d1npha1: