![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.2: Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) [48184] (3 proteins) |
![]() | Protein Class I ketol-acid reductoisomerase [89101] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [89102] (1 PDB entry) |
![]() | Domain d1np3a1: 1np3 A:183-327 [85946] Other proteins in same PDB: d1np3a2, d1np3b2, d1np3c2, d1np3d2 |
PDB Entry: 1np3 (more details), 2 Å
SCOPe Domain Sequences for d1np3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1np3a1 a.100.1.2 (A:183-327) Class I ketol-acid reductoisomerase {Pseudomonas aeruginosa [TaxId: 287]} fkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmyegg ianmnysisnnaeygeyvtgpevinaesraamrnalkriqdgeyakmfitegaanypsmt ayrrnnaahpieqigeklrammpwi
Timeline for d1np3a1: