| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) ![]() crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site |
| Family a.25.2.2: Cobalamin adenosyltransferase [89032] (3 proteins) automatically mapped to Pfam PF01923 |
| Protein Hypothetical protein Ta0546 [89033] (1 species) |
| Species Thermoplasma acidophilum [TaxId:2303] [89034] (1 PDB entry) |
| Domain d1noga_: 1nog A: [85923] structural genomics |
PDB Entry: 1nog (more details), 1.55 Å
SCOPe Domain Sequences for d1noga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1noga_ a.25.2.2 (A:) Hypothetical protein Ta0546 {Thermoplasma acidophilum [TaxId: 2303]}
spvvevqgtidelnsfigyalvlsrwddirndlfriqndlfvlgedvstggkgrtvtrem
idylearvkemkaeigkielfvvpggsvesaslhmaravsrrlerrivaasklteinknv
liyanrlssilfmhalisnkrlnipekiw
Timeline for d1noga_: