Class g: Small proteins [56992] (98 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (4 families) |
Family g.41.5.1: Rubredoxin [57803] (5 proteins) |
Protein Rubrerythrin, C-terminal domain [57811] (2 species) |
Species Pyrococcus furiosus [TaxId:2261] [103622] (2 PDB entries) |
Domain d1nnqa2: 1nnq A:135-171 [92007] Other proteins in same PDB: d1nnqa1, d1nnqb1 structural genomics complexed with zn |
PDB Entry: 1nnq (more details), 2.35 Å
SCOPe Domain Sequences for d1nnqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]} eikkvyicpicgytavdeapeycpvcgapkekfvvfe
Timeline for d1nnqa2: