Lineage for d1nnqa1 (1nnq A:2-134)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1264123Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1264975Protein Rubrerythrin, N-terminal domain [47242] (2 species)
  7. 1264987Species Pyrococcus furiosus [TaxId:2261] [101129] (2 PDB entries)
  8. 1264988Domain d1nnqa1: 1nnq A:2-134 [92006]
    Other proteins in same PDB: d1nnqa2, d1nnqb2
    structural genomics
    complexed with zn

Details for d1nnqa1

PDB Entry: 1nnq (more details), 2.35 Å

PDB Description: rubrerythrin from pyrococcus furiosus pfu-1210814
PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d1nnqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nnqa1 a.25.1.1 (A:2-134) Rubrerythrin, N-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedi

SCOPe Domain Coordinates for d1nnqa1:

Click to download the PDB-style file with coordinates for d1nnqa1.
(The format of our PDB-style files is described here.)

Timeline for d1nnqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nnqa2