Lineage for d1nni1_ (1nni 1:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691939Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 692141Family c.23.5.4: NADPH-dependent FMN reductase [89590] (4 proteins)
    Pfam PF03358
  6. 692142Protein Azobenzene reductase [89591] (1 species)
  7. 692143Species Bacillus subtilis [TaxId:1423] [89592] (2 PDB entries)
    YhdA gene product
  8. 692144Domain d1nni1_: 1nni 1: [85904]
    structural genomics
    complexed with fmn, mse

Details for d1nni1_

PDB Entry: 1nni (more details), 2.5 Å

PDB Description: Azobenzene Reductase from Bacillus subtilis
PDB Compounds: (1:) hypothetical protein yhda

SCOP Domain Sequences for d1nni1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nni1_ c.23.5.4 (1:) Azobenzene reductase {Bacillus subtilis [TaxId: 1423]}
mnmlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqr
vtkadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrt
vmrgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakagn

SCOP Domain Coordinates for d1nni1_:

Click to download the PDB-style file with coordinates for d1nni1_.
(The format of our PDB-style files is described here.)

Timeline for d1nni1_: