Lineage for d1nngb_ (1nng B:)
- Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds) 
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
core: beta-alpha-beta(4); 2 layers: alpha/betaSuperfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (6 families) 
Family d.38.1.1: 4HBT-like [54638] (5 proteins)
Pfam 03061
Protein Putative acyl-coa thioester hydrolase HI0827 [102903] (1 species) Species Haemophilus influenzae [TaxId:727] [102904] (1 PDB entry) 
Domain d1nngb_: 1nng B: [92004]
structural genomics
complexed with ca, coa, gol
Details for d1nngb_
PDB Entry: 1nng (more details), 1.95 Å
PDB Description: Structure of HI0827, a thioesterase acting on short-chain acyl-CoA compounds.
SCOP Domain Sequences for d1nngb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nngb_ d.38.1.1 (B:) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae}
ftdkngrqskgvlllrtlampsdtnangdifggwimsqmdmggailakeiahgrvvtvav
esmnfikpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfva
vdnngrsrtiprennqelekalaliseq
SCOP Domain Coordinates for d1nngb_:
Click to download the PDB-style file with coordinates for d1nngb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nngb_:
- d1nngb_ first appeared in SCOP 1.67
- d1nngb_ appears in SCOP 1.69
- d1nngb_ does not appear in SCOP 1.73
View in 3D
