Lineage for d1nmwa_ (1nmw A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941338Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2941483Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species)
    Domain 1 is a WW-domain
  7. 2941484Species Human (Homo sapiens) [TaxId:9606] [54548] (52 PDB entries)
  8. 2941537Domain d1nmwa_: 1nmw A: [85881]
    PPI domain only
    complexed with so4

    has additional insertions and/or extensions that are not grouped together

Details for d1nmwa_

PDB Entry: 1nmw (more details)

PDB Description: Solution structure of the PPIase domain of human Pin1
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d1nmwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmwa_ d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}
geparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasq
fsdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte

SCOPe Domain Coordinates for d1nmwa_:

Click to download the PDB-style file with coordinates for d1nmwa_.
(The format of our PDB-style files is described here.)

Timeline for d1nmwa_: