![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
![]() | Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species) Domain 1 is a WW-domain |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54548] (52 PDB entries) |
![]() | Domain d1nmwa_: 1nmw A: [85881] PPI domain only complexed with so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1nmw (more details)
SCOPe Domain Sequences for d1nmwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nmwa_ d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} geparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasq fsdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte
Timeline for d1nmwa_: