Lineage for d1nmoa_ (1nmo A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2530505Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily)
    consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest
  4. 2530506Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (2 families) (S)
    di-iron binding protein
  5. 2530507Family c.135.1.1: NIF3 (NGG1p interacting factor 3)-like [102706] (3 proteins)
    Pfam PF01784
  6. 2530513Protein Hypothetical protein YbgI [102707] (1 species)
  7. 2530514Species Escherichia coli [TaxId:562] [102708] (2 PDB entries)
  8. 2530521Domain d1nmoa_: 1nmo A: [91980]
    structural genomics
    complexed with fe

Details for d1nmoa_

PDB Entry: 1nmo (more details), 2.2 Å

PDB Description: structural genomics, protein ybgi, unknown function
PDB Compounds: (A:) Hypothetical protein ybgI

SCOPe Domain Sequences for d1nmoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmoa_ c.135.1.1 (A:) Hypothetical protein YbgI {Escherichia coli [TaxId: 562]}
mknteleqlineklnsaaisdyapnglqvegketvqkivtgvtasqalldeavrlgadav
ivhhgyfwkgespvirgmkrnrlktllandinlygwhlpldahpelgnnaqlaallgitv
mgeieplvpwgeltmpvpglelaswiearlgrkplwcgdtgpevvqrvawctgggqsfid
saarfgvdafitgevseqtihsareqglhfyaaghhaterggiralsewlnentdldvtf
idipnpa

SCOPe Domain Coordinates for d1nmoa_:

Click to download the PDB-style file with coordinates for d1nmoa_.
(The format of our PDB-style files is described here.)

Timeline for d1nmoa_: