| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily) consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest |
Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (2 families) ![]() di-iron binding protein |
| Family c.135.1.1: NIF3 (NGG1p interacting factor 3)-like [102706] (3 proteins) Pfam PF01784 |
| Protein Hypothetical protein YbgI [102707] (1 species) |
| Species Escherichia coli [TaxId:562] [102708] (2 PDB entries) |
| Domain d1nmoa_: 1nmo A: [91980] structural genomics complexed with fe |
PDB Entry: 1nmo (more details), 2.2 Å
SCOPe Domain Sequences for d1nmoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nmoa_ c.135.1.1 (A:) Hypothetical protein YbgI {Escherichia coli [TaxId: 562]}
mknteleqlineklnsaaisdyapnglqvegketvqkivtgvtasqalldeavrlgadav
ivhhgyfwkgespvirgmkrnrlktllandinlygwhlpldahpelgnnaqlaallgitv
mgeieplvpwgeltmpvpglelaswiearlgrkplwcgdtgpevvqrvawctgggqsfid
saarfgvdafitgevseqtihsareqglhfyaaghhaterggiralsewlnentdldvtf
idipnpa
Timeline for d1nmoa_: