Lineage for d1nmbn_ (1nmb N:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074740Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2074741Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2074742Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2074755Protein Influenza neuraminidase [50943] (4 species)
  7. 2074766Species Influenza A virus, different strains [TaxId:11320] [50944] (78 PDB entries)
    Uniprot P03472 84-470
  8. 2074832Domain d1nmbn_: 1nmb N: [27583]
    Other proteins in same PDB: d1nmbh_, d1nmbl_
    complexed with ca, nag

Details for d1nmbn_

PDB Entry: 1nmb (more details), 2.2 Å

PDB Description: the structure of a complex between the nc10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the nc41 antibody
PDB Compounds: (N:) n9 neuraminidase

SCOPe Domain Sequences for d1nmbn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmbn_ b.68.1.1 (N:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
refnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyrdliswplsspptvynsrvecigwsstschdgrarmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvcqngvcpvvftdgsatgpaetriyyfkeg
kilkwepltgtakhieecscygeqagvtctcrdnwqgsnrpviqidpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldggntwlgrtisiasrsgyemlkvpn
altddrskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwnwpdgakieyfl

SCOPe Domain Coordinates for d1nmbn_:

Click to download the PDB-style file with coordinates for d1nmbn_.
(The format of our PDB-style files is described here.)

Timeline for d1nmbn_: