Lineage for d1nknb_ (1nkn B:)

  1. Root: SCOPe 2.03
  2. 1466120Class h: Coiled coil proteins [57942] (7 folds)
  3. 1466121Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1467161Superfamily h.1.26: Myosin rod fragments [90257] (1 family) (S)
  5. 1467162Family h.1.26.1: Myosin rod fragments [90258] (2 proteins)
  6. 1467171Protein Myosin S2N51 [90259] (1 species)
  7. 1467172Species Bay scallop (Argopecten irradians) [TaxId:31199] [90260] (2 PDB entries)
  8. 1467176Domain d1nknb_: 1nkn B: [85826]
    contains a fragment of the yeast GCN4 leucine zipper

Details for d1nknb_

PDB Entry: 1nkn (more details), 2.5 Å

PDB Description: visualizing an unstable coiled coil: the crystal structure of an n-terminal segment of the scallop myosin rod
PDB Compounds: (B:) s2n51-gcn4

SCOPe Domain Sequences for d1nknb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nknb_ h.1.26.1 (B:) Myosin S2N51 {Bay scallop (Argopecten irradians) [TaxId: 31199]}
eeemkeqlkqmdkmkedlakterikkeleeqnvtlleqkndlfgsmkqledkveellskn
yhlenevarlkklvge

SCOPe Domain Coordinates for d1nknb_:

Click to download the PDB-style file with coordinates for d1nknb_.
(The format of our PDB-style files is described here.)

Timeline for d1nknb_: