SCOPe 2.04: Domain d1nj9a1: 1nj9 A:1-108

Lineage for d1nj9a1 (1nj9 A:1-108)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

Species Mouse (Mus musculus) [TaxId:10090] [88541] (35 PDB entries)
Domain d1nj9a1: 1nj9 A:1-108 [91897]
Other proteins in same PDB: d1nj9a2, d1nj9b1, d1nj9b2, d1nj9h1, d1nj9h2, d1nj9l2
part of cocaine hydrolytic Fab 15a10
complexed with na

Details for d1nj9a1

PDB Entry: 1nj9 (more details), 2.35 Å

PDB Description: cocaine hydrolytic antibody 15a10

PDB Compounds: (A:) immunoglobulin variable chain

SCOPe Domain Sequences for d1nj9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nj9a1 b.1.1.1 (A:1-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgtitsdnyanwvqekpdhlfsgligvnnarppgv
parfsgsltgdkavltitgaqtedeaiyfcalwysnhwvfgggtkltvlg

SCOPe Domain Coordinates for d1nj9a1:

Click to download the PDB-style file with coordinates for d1nj9a1.
(The format of our PDB-style files is described here.)

Timeline for d1nj9a1: