Lineage for d1nifa1 (1nif A:8-166)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (8 families) 
contains copper-binding siteFamily b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) Species Achromobacter cycloclastes [TaxId:223] [419324] (51 PDB entries) 
Domain d1nifa1: 1nif A:8-166 [23048]
Other proteins in same PDB: d1nifa2
complexed with cu
Details for d1nifa1
PDB Entry: 1nif (more details), 1.7 Å
PDB Description: the structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
PDB Compounds: (A:) nitrite reductaseSCOPe Domain Sequences for d1nifa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nifa1 b.6.1.3 (A:8-166) Nitrite reductase, NIR, N-terminal domain {Achromobacter cycloclastes [TaxId: 223]}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek
SCOPe Domain Coordinates for d1nifa1:
Click to download the PDB-style file with coordinates for d1nifa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nifa1:
- d1nifa1 first appeared (with stable ids) in SCOP 1.55, called d1nif_1
- d1nifa1 appears in SCOPe 2.07
View in 3D
