Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) iron-sulfur cluster assembly proteins |
Family d.224.1.1: SufE-like [82650] (3 proteins) Fe-S metabolism associated domain automatically mapped to Pfam PF02657 |
Protein Hypothetical protein YgdK [89912] (1 species) |
Species Escherichia coli [TaxId:562] [89913] (1 PDB entry) |
Domain d1ni7a_: 1ni7 A: [85738] structural genomics; NESG target ER75 |
PDB Entry: 1ni7 (more details)
SCOPe Domain Sequences for d1ni7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ni7a_ d.224.1.1 (A:) Hypothetical protein YgdK {Escherichia coli [TaxId: 562]} mtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiag cenrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelg lraqlsasrsqglnalseaiiaatkqvle
Timeline for d1ni7a_: