![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins) |
![]() | Protein Heme oxygenase-1 (HO-1) [48615] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48616] (23 PDB entries) Uniprot P09601 |
![]() | Domain d1ni6c_: 1ni6 C: [85736] heme-free structure complexed with cl, tre |
PDB Entry: 1ni6 (more details), 2.1 Å
SCOPe Domain Sequences for d1ni6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ni6c_ a.132.1.1 (C:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]} merpqpdsmpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyva leeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhe vgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkq lyrsrmnslemtpavrqrvieeaktafllniqlfeelqellth
Timeline for d1ni6c_: