Lineage for d1ni3a2 (1ni3 A:307-388)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.10: TGS-like [81271] (3 families) 
possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif
Family d.15.10.2: G domain-linked domain [82583] (2 proteins) Protein YchF GTP-binding protein, C-terminal domain [82584] (2 species)
N-terminal domain belongs to the Obg family of GTPases some members of which contain a C-terminal TGS domain
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82585] (1 PDB entry) 
Domain d1ni3a2: 1ni3 A:307-388 [80532]
Other proteins in same PDB: d1ni3a1
complexed with so4
Details for d1ni3a2
PDB Entry: 1ni3 (more details), 2.8 Å
PDB Description: structure of the schizosaccharomyces pombe ychf gtpase
PDB Compounds: (A:) YchF GTP-binding proteinSCOPe Domain Sequences for d1ni3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ni3a2 d.15.10.2 (A:307-388) YchF GTP-binding protein, C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
linyftcgedevrswtirkgtkapqaagvihtdfekafvvgeimhyqdlfdyktenacra
agkyltkgkeyvmesgdiahwk
SCOPe Domain Coordinates for d1ni3a2:
Click to download the PDB-style file with coordinates for d1ni3a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ni3a2:
- d1ni3a2 first appeared in SCOP 1.63
- d1ni3a2 appears in SCOPe 2.04
- d1ni3a2 appears in SCOPe 2.06
- d1ni3a2 appears in the current release, SCOPe 2.08
View in 3D
