Lineage for d1ni2a2 (1ni2 A:199-297)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1799258Family b.55.1.5: Third domain of FERM [50776] (9 proteins)
  6. 1799264Protein Ezrin [82142] (1 species)
    complexed with the icam-2 cytoplasmic peptide, chain B
  7. 1799265Species Human (Homo sapiens) [TaxId:9606] [82143] (1 PDB entry)
  8. 1799266Domain d1ni2a2: 1ni2 A:199-297 [80526]
    Other proteins in same PDB: d1ni2a1, d1ni2a3, d1ni2b1, d1ni2b3

Details for d1ni2a2

PDB Entry: 1ni2 (more details), 2.3 Å

PDB Description: structure of the active ferm domain of ezrin
PDB Compounds: (A:) Ezrin

SCOPe Domain Sequences for d1ni2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni2a2 b.55.1.5 (A:199-297) Ezrin {Human (Homo sapiens) [TaxId: 9606]}
emyginyfeiknkkgtdlwlgvdalglniyekddkltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilqlcmgnhelymrrrkp

SCOPe Domain Coordinates for d1ni2a2:

Click to download the PDB-style file with coordinates for d1ni2a2.
(The format of our PDB-style files is described here.)

Timeline for d1ni2a2: