Lineage for d1nhkr_ (1nhk R:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) 
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) 
Species Myxococcus xanthus [TaxId:34] [54927] (3 PDB entries) 
Domain d1nhkr_: 1nhk R: [39141]
complexed with cmp
Details for d1nhkr_
PDB Entry: 1nhk (more details), 1.9 Å
PDB Description: crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution
PDB Compounds: (R:) Nucleoside diphosphate kinaseSCOPe Domain Sequences for d1nhkr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nhkr_ d.58.6.1 (R:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]}
aiertlsiikpdglekgvigkiisrfeekglkpvairlqhlsqaqaegfyavhkarpffk
dlvqfmisgpvvlmvlegenavlanrdimgatnpaqaaegtirkdfatsidkntvhgsds
lenakieiayffreteihsypyqk
SCOPe Domain Coordinates for d1nhkr_:
Click to download the PDB-style file with coordinates for d1nhkr_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nhkr_:
View in 3D
