| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
| Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) |
| Species Myxococcus xanthus [TaxId:34] [54927] (3 PDB entries) |
| Domain d1nhkr_: 1nhk R: [39141] complexed with cmp |
PDB Entry: 1nhk (more details), 1.9 Å
SCOPe Domain Sequences for d1nhkr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nhkr_ d.58.6.1 (R:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]}
aiertlsiikpdglekgvigkiisrfeekglkpvairlqhlsqaqaegfyavhkarpffk
dlvqfmisgpvvlmvlegenavlanrdimgatnpaqaaegtirkdfatsidkntvhgsds
lenakieiayffreteihsypyqk
Timeline for d1nhkr_: