Lineage for d1nhkr_ (1nhk R:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951072Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2951208Species Myxococcus xanthus [TaxId:34] [54927] (3 PDB entries)
  8. 2951210Domain d1nhkr_: 1nhk R: [39141]
    complexed with cmp

Details for d1nhkr_

PDB Entry: 1nhk (more details), 1.9 Å

PDB Description: crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution
PDB Compounds: (R:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1nhkr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhkr_ d.58.6.1 (R:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]}
aiertlsiikpdglekgvigkiisrfeekglkpvairlqhlsqaqaegfyavhkarpffk
dlvqfmisgpvvlmvlegenavlanrdimgatnpaqaaegtirkdfatsidkntvhgsds
lenakieiayffreteihsypyqk

SCOPe Domain Coordinates for d1nhkr_:

Click to download the PDB-style file with coordinates for d1nhkr_.
(The format of our PDB-style files is described here.)

Timeline for d1nhkr_: