Lineage for d1nh8a2 (1nh8 A:211-284)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.5: GlnB-like [54913] (6 families) 
form timeric structures with the orthogonally packed beta-sheets
Family d.58.5.3: ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain [88851] (1 protein)
automatically mapped to Pfam PF08029Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain [82669] (2 species)
binds allosteric inhibitor histidineSpecies Mycobacterium tuberculosis [TaxId:1773] [82670] (2 PDB entries) 
Domain d1nh8a2: 1nh8 A:211-284 [80508]
Other proteins in same PDB: d1nh8a1
complexed with amp, his, so4
Details for d1nh8a2
PDB Entry: 1nh8 (more details), 1.8 Å
PDB Description: atp phosphoribosyltransferase (atp-prtase) from mycobacterium tuberculosis in complex with amp and histidine
PDB Compounds: (A:) ATP phosphoribosyltransferaseSCOPe Domain Sequences for d1nh8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nh8a2 d.58.5.3 (A:211-284) ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
qylmldydcprsalkkataitpglesptiapladpdwvairalvprrdvngimdelaaig
akailasdirfcrf
SCOPe Domain Coordinates for d1nh8a2:
Click to download the PDB-style file with coordinates for d1nh8a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nh8a2:
- d1nh8a2 first appeared in SCOP 1.63
- d1nh8a2 appears in SCOPe 2.07
View in 3D
