Lineage for d1nh2d2 (1nh2 D:55-121)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673451Fold b.56: Transcription factor IIA (TFIIA), beta-barrel domain [50783] (1 superfamily)
    barrel, closed; n=6, S=12; mixed beta-sheet
  4. 673452Superfamily b.56.1: Transcription factor IIA (TFIIA), beta-barrel domain [50784] (1 family) (S)
    dimer of non-identical beta-sheet domains
  5. 673453Family b.56.1.1: Transcription factor IIA (TFIIA), beta-barrel domain [50785] (2 proteins)
    heterodimer of two homologous chains
  6. 673460Protein Small chain TOA2, C-terminal domain [88686] (2 species)
  7. 673461Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88687] (3 PDB entries)
  8. 673462Domain d1nh2d2: 1nh2 D:55-121 [91877]
    Other proteins in same PDB: d1nh2a1, d1nh2a2, d1nh2b_, d1nh2c_, d1nh2d1
    complexed with 5iu

Details for d1nh2d2

PDB Entry: 1nh2 (more details), 1.9 Å

PDB Description: crystal structure of a yeast tfiia/tbp/dna complex
PDB Compounds: (D:) Transcription initiation factor IIA small chain

SCOP Domain Sequences for d1nh2d2:

Sequence, based on SEQRES records: (download)

>d1nh2d2 b.56.1.1 (D:55-121) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntqskltvkgnldtygfcddvwtfivkncqvtvedshrdasqngsgdsqsvisvdklriv
acnskks

Sequence, based on observed residues (ATOM records): (download)

>d1nh2d2 b.56.1.1 (D:55-121) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntqskltvkgnldtygfcddvwtfivkncqvtvedqsvisvdklrivacnskks

SCOP Domain Coordinates for d1nh2d2:

Click to download the PDB-style file with coordinates for d1nh2d2.
(The format of our PDB-style files is described here.)

Timeline for d1nh2d2:

673462
d1nh2d2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1nh2d1