Lineage for d1nh1a_ (1nh1 A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2625954Fold e.45: Antivirulence factor [103382] (1 superfamily)
    contains a helical bundle with a buried helix and an alpha+beta insert domain
  4. 2625955Superfamily e.45.1: Antivirulence factor [103383] (1 family) (S)
    automatically mapped to Pfam PF05394
  5. 2625956Family e.45.1.1: Antivirulence factor [103384] (1 protein)
  6. 2625957Protein Type III effector AvrB [103385] (1 species)
  7. 2625958Species Pseudomonas syringae [TaxId:317] [103386] (3 PDB entries)
  8. 2625959Domain d1nh1a_: 1nh1 A: [91871]

Details for d1nh1a_

PDB Entry: 1nh1 (more details), 2.2 Å

PDB Description: Crystal Structure of the Type III Effector AvrB from Pseudomonas syringae.
PDB Compounds: (A:) Avirulence B protein

SCOPe Domain Sequences for d1nh1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nh1a_ e.45.1.1 (A:) Type III effector AvrB {Pseudomonas syringae [TaxId: 317]}
alpgpsqrqlevydqcligaarwpddssksntpenraycqsmynsirsagdeisrggits
feelwgratewrlsklqrgeplysafasertsdtdavtplvkpyksvlarvvdhedahde
imqdnlfgdlnvkvyrqtaylhgnviplntfrvatdteylrdrvahlrtelgakalkqhl
qrynpdridhtnasylpiikdhlndlyrqaissdlsqaelisliarthwwaasampdqrg
saakaefaaraiasahgielppfrngnvsdieamlsgeeefvekyrslld

SCOPe Domain Coordinates for d1nh1a_:

Click to download the PDB-style file with coordinates for d1nh1a_.
(The format of our PDB-style files is described here.)

Timeline for d1nh1a_: