Lineage for d1ngzb2 (1ngz B:115-220)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.1: Immunoglobulin [48726] (4 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) 
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) 
Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
SQ NA # humanized antibody
Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region
SQ NA # engineered antibody
including humanized antibodies (chimeric proteins with human constant domains)
Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
Domain d1ngzb2: 1ngz B:115-220 [80503]
Other proteins in same PDB: d1ngza1, d1ngza2, d1ngzb1
part of metal chelatase catalytic Fab 7G12;chimeric germline antibody
Details for d1ngzb2
PDB Entry: 1ngz (more details), 1.6 Å
PDB Description: Chimeric Germline Fab 7g12-apo
PDB Compounds: (B:) Germline Metal Chelatase Catalytic Antibody, Heavy chainSCOP Domain Sequences for d1ngzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngzb2 b.1.1.2 (B:115-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkt
SCOP Domain Coordinates for d1ngzb2:
Click to download the PDB-style file with coordinates for d1ngzb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ngzb2:
- d1ngzb2 first appeared in SCOP 1.63
- d1ngzb2 appears in SCOP 1.73
- d1ngzb2 appears in SCOPe 2.01
- d1ngzb2 appears in the current release, SCOPe 2.08
View in 3D
