Lineage for d1ngzb2 (1ngz B:115-220)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655115Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 655338Domain d1ngzb2: 1ngz B:115-220 [80503]
    Other proteins in same PDB: d1ngza1, d1ngza2, d1ngzb1
    part of metal chelatase catalytic Fab 7G12;chimeric germline antibody

Details for d1ngzb2

PDB Entry: 1ngz (more details), 1.6 Å

PDB Description: Chimeric Germline Fab 7g12-apo
PDB Compounds: (B:) Germline Metal Chelatase Catalytic Antibody, Heavy chain

SCOP Domain Sequences for d1ngzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngzb2 b.1.1.2 (B:115-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkt

SCOP Domain Coordinates for d1ngzb2:

Click to download the PDB-style file with coordinates for d1ngzb2.
(The format of our PDB-style files is described here.)

Timeline for d1ngzb2:

655338
d1ngzb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ngzb1