Lineage for d1nfja_ (1nfj A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912692Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 1913007Superfamily d.68.6: AlbA-like [82704] (3 families) (S)
  5. 1913008Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins)
  6. 1913009Protein DNA-binding protein AlbA [82706] (4 species)
    an archaeal chromatin protein modulated by acetylation, a Sir2 substrate
  7. 1913010Species Archaeoglobus fulgidus [TaxId:2234] [103059] (2 PDB entries)
    gene AF1956
  8. 1913011Domain d1nfja_: 1nfj A: [91866]

Details for d1nfja_

PDB Entry: 1nfj (more details), 2 Å

PDB Description: Structure of a Sir2 substrate, alba, reveals a mechanism for deactylation-induced enhancement of DNA-binding
PDB Compounds: (A:) conserved hypothetical protein AF1956

SCOPe Domain Sequences for d1nfja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfja_ d.68.6.1 (A:) DNA-binding protein AlbA {Archaeoglobus fulgidus [TaxId: 2234]}
ehvvyvgnkpvmnyvlatltqlnegadevvikargraisravdvaeivrnrfmpgvkvke
ikidteeleseqgrrsnvstieivlak

SCOPe Domain Coordinates for d1nfja_:

Click to download the PDB-style file with coordinates for d1nfja_.
(The format of our PDB-style files is described here.)

Timeline for d1nfja_: