SCOPe 2.08: Domain d1nfdb1: 1nfd B:1-117

Lineage for d1nfdb1 (1nfd B:1-117)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries)
Domain d1nfdb1: 1nfd B:1-117 [20635]
Other proteins in same PDB: d1nfda2, d1nfdb2, d1nfdc2, d1nfdd2, d1nfde1, d1nfde2, d1nfdf1, d1nfdf2, d1nfdg1, d1nfdg2, d1nfdh1, d1nfdh2
complexed with nag

Details for d1nfdb1

PDB Entry: 1nfd (more details), 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody

PDB Compounds: (B:) n15 alpha-beta T-cell receptor

SCOPe Domain Sequences for d1nfdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgfl
psrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvle

SCOPe Domain Coordinates for d1nfdb1:

Click to download the PDB-style file with coordinates for d1nfdb1.
(The format of our PDB-style files is described here.)

Timeline for d1nfdb1: