Lineage for d1nf9a_ (1nf9 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864173Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864174Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2864175Family c.33.1.3: Isochorismatase-like hydrolases [100948] (7 proteins)
  6. 2864188Protein Phenazine biosynthesis protein PhzD [89643] (2 species)
  7. 2864189Species Pseudomonas aeruginosa [TaxId:287] [89644] (2 PDB entries)
  8. 2864190Domain d1nf9a_: 1nf9 A: [85631]
    complexed with bog, fmt

Details for d1nf9a_

PDB Entry: 1nf9 (more details), 1.5 Å

PDB Description: crystal structure of phzd protein from pseudomonas aeruginosa
PDB Compounds: (A:) phenazine biosynthesis protein phzD

SCOPe Domain Sequences for d1nf9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nf9a_ c.33.1.3 (A:) Phenazine biosynthesis protein PhzD {Pseudomonas aeruginosa [TaxId: 287]}
msgipeitayplptaqqlpanlarwsleprravllvhdmqryflrplpeslraglvanaa
rlrrwcveqgvqiaytaqpgsmteeqrgllkdfwgpgmraspadrevveelapgpddwll
tkwrysaffhsdllqrmraagrdqlvlcgvyahvgvlistvdaysndiqpflvadaiadf
seahhrmaleyaasrcamvvttdevle

SCOPe Domain Coordinates for d1nf9a_:

Click to download the PDB-style file with coordinates for d1nf9a_.
(The format of our PDB-style files is described here.)

Timeline for d1nf9a_: