Lineage for d1nf4a_ (1nf4 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766114Protein Bacterioferritin (cytochrome b1) [47244] (4 species)
    binds heme between two subunits; 24-mer
  7. 766140Species Desulfovibrio desulfuricans [TaxId:876] [89025] (3 PDB entries)
  8. 766141Domain d1nf4a_: 1nf4 A: [85598]

Details for d1nf4a_

PDB Entry: 1nf4 (more details), 2.05 Å

PDB Description: x-ray structure of the desulfovibrio desulfuricans bacterioferritin: the diiron site in different states (reduced structure)
PDB Compounds: (A:) bacterioferritin

SCOP Domain Sequences for d1nf4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nf4a_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans [TaxId: 876]}
nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf
aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar
lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv

SCOP Domain Coordinates for d1nf4a_:

Click to download the PDB-style file with coordinates for d1nf4a_.
(The format of our PDB-style files is described here.)

Timeline for d1nf4a_: