Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins) contains an alpha+beta subdomain inserted into a new site after strand 3 |
Protein Hypothetical protein TM0651 [102313] (1 species) |
Species Thermotoga maritima [TaxId:2336] [102314] (1 PDB entry) |
Domain d1nf2a_: 1nf2 A: [91849] structural genomics complexed with mg, so4 |
PDB Entry: 1nf2 (more details), 2.2 Å
SCOPe Domain Sequences for d1nf2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} myrvfvfdldgtllndnleisekdrrnieklsrkcyvvfasgrmlvstlnvekkyfkrtf ptiayngaivylpeegvilnekippevakdiieyikplnvhwqayiddvlysekdneeik syarhsnvdyrvepnlselvskmgttklllidtperldelkeilserfkdvvkvfksfpt yleivpknvdkgkalrflrermnwkkeeivvfgdnendlfmfeeaglrvamenaiekvke asdivtltnndsgvsyvleristdcld
Timeline for d1nf2a_: