Lineage for d1nf2a_ (1nf2 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1187611Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1187612Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1187856Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 1187857Protein Hypothetical protein TM0651 [102313] (1 species)
  7. 1187858Species Thermotoga maritima [TaxId:2336] [102314] (1 PDB entry)
  8. 1187859Domain d1nf2a_: 1nf2 A: [91849]
    structural genomics
    complexed with mg, so4

Details for d1nf2a_

PDB Entry: 1nf2 (more details), 2.2 Å

PDB Description: X-ray crystal structure of TM0651 from Thermotoga maritima
PDB Compounds: (A:) phosphatase

SCOPe Domain Sequences for d1nf2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]}
myrvfvfdldgtllndnleisekdrrnieklsrkcyvvfasgrmlvstlnvekkyfkrtf
ptiayngaivylpeegvilnekippevakdiieyikplnvhwqayiddvlysekdneeik
syarhsnvdyrvepnlselvskmgttklllidtperldelkeilserfkdvvkvfksfpt
yleivpknvdkgkalrflrermnwkkeeivvfgdnendlfmfeeaglrvamenaiekvke
asdivtltnndsgvsyvleristdcld

SCOPe Domain Coordinates for d1nf2a_:

Click to download the PDB-style file with coordinates for d1nf2a_.
(The format of our PDB-style files is described here.)

Timeline for d1nf2a_: