Lineage for d1nepa_ (1nep A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1299863Family b.1.18.7: ML domain [81287] (2 proteins)
    implicated in lipid recognition, particularly in the recognition of pathogen related products
    automatically mapped to Pfam PF02221
  6. 1299864Protein Epididymal secretory protein E1 (Niemann-Pick C2 protein) [81964] (1 species)
    a cholesterol binding protein
  7. 1299865Species Cow (Bos taurus) [TaxId:9913] [81965] (2 PDB entries)
  8. 1299866Domain d1nepa_: 1nep A: [80440]
    complexed with nag, po4

Details for d1nepa_

PDB Entry: 1nep (more details), 1.7 Å

PDB Description: crystal structure analysis of the bovine npc2 (niemann-pick c2) protein
PDB Compounds: (A:) Epididymal secretory protein E1

SCOPe Domain Sequences for d1nepa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nepa_ b.1.18.7 (A:) Epididymal secretory protein E1 (Niemann-Pick C2 protein) {Cow (Bos taurus) [TaxId: 9913]}
epvkfkdcgswvgvikevnvspcptqpcklhrgqsysvnvtftsntqsqsskavvhgivm
gipvpfpipesdgcksgircpiekdktynyvnklpvkneypsikvvveweltddknqrff
cwqipievea

SCOPe Domain Coordinates for d1nepa_:

Click to download the PDB-style file with coordinates for d1nepa_.
(The format of our PDB-style files is described here.)

Timeline for d1nepa_: