Lineage for d1nekb2 (1nek B:1-106)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) 
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) 
Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species) 
Species Escherichia coli [TaxId:562] [82587] (6 PDB entries) 
Domain d1nekb2: 1nek B:1-106 [80430]
Other proteins in same PDB: d1neka1, d1neka2, d1neka3, d1nekb1, d1nekc_, d1nekd_
complexed with ca, cdn, eph, f3s, fad, fes, hem, oaa, sf4, uq2
Details for d1nekb2
PDB Entry: 1nek (more details), 2.6 Å
PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with ubiquinone bound
PDB Compounds: (B:) Succinate dehydrogenase iron-sulfur proteinSCOPe Domain Sequences for d1nekb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]}
mrlefsiyrynpdvddaprmqdytleadegrdmmlldaliqlkekdpslsfrrscregvc
gsdglnmngknglacitpisalnqpgkkivirplpglpvirdlvvd
SCOPe Domain Coordinates for d1nekb2:
Click to download the PDB-style file with coordinates for d1nekb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nekb2:
- d1nekb2 first appeared in SCOP 1.63
- d1nekb2 appears in SCOPe 2.06
- d1nekb2 appears in the current release, SCOPe 2.08
View in 3D
